{"product_id":"proteintech-14166-1-ap","title":"Proteintech, 14166-1-AP, PTH2R Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTH2R (14166-1-AP) by Proteintech is a Polyclonal antibody targeting PTH2R in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14166-1-AP targets PTH2R in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells,  BxPC-3 cells,  human testis tissue,  mouse liver tissue,  mouse pancreas tissue,  mouse testis tissue\nPositive IHC detected in: human pancreas cancer tissue,  human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nParathyroid hormone 2 receptor (PTH2R, also known as PTHR2) is a member of the secretin receptor family of G protein-coupled receptors. PTH2R selectively recognizes parathyroid hormone and is particularly abundant in the brain and pancreas (PMID: 7797535). Tuberoinfundibular peptide of 39 residues (TIP39) is the endogenous ligand of the PTH2R in the brain, and they form a neuromodulator system (PMID: 19857544). PTH2R is involved in the regulation of calcium transport, nociception mediation, and wound healing (PMID: 34353904).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5364 Product name: Recombinant human PTH2R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 419-550 aa of BC036811 Sequence: EVQAEVKKMWSRWNLSVDWKRTPPCGSRRCGSVLTTVTHSTSSQSQVAASTRMVLISGKAAKIASRQPDSHITLPGYVWSNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESNPDTEGCQGETEDVL Predict reactive species\nFull Name: parathyroid hormone 2 receptor\nCalculated Molecular Weight: 550 aa, 62 kDa\nObserved Molecular Weight: 62-66 kDa\nGenBank Accession Number: BC036811\nGene Symbol: PTH2R\nGene ID (NCBI): 5746\nRRID: AB_2253212\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49190\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869746286761,"sku":"14166-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14166-1-ap","provider":"Iright","version":"1.0","type":"link"}