{"product_id":"proteintech-14170-1-ap","title":"Proteintech, 14170-1-AP, UGCGL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UGCGL1 (14170-1-AP) by Proteintech is a Polyclonal antibody targeting UGCGL1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14170-1-AP targets UGCGL1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human pancreas cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUDP-glucose:glycoprotein glucosyltransferase 1 (UGCGL1) is a central quality control gatekeeper in the mammalian endoplasmic reticulum (ER) and serves as a folding sensor in the calnexin\/calreticulin glycoprotein quality control cycle (PMID: 28425917). UGCGL1 acts as a checkpoint in the quality control of the MHC class I antigen presentation pathway (PMID: 21383159). Western blot analysis detected UGCGL1 at an apparent molecular mass of 170 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5369 Product name: Recombinant human UGCGL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1221-1531 aa of BC041098 Sequence: TEEVKQDKDDIINIFSVASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYKWPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPYGYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL Predict reactive species\nFull Name: UDP-glucose ceramide glucosyltransferase-like 1\nCalculated Molecular Weight: 1531 aa, 175 kDa\nObserved Molecular Weight: 170 kDa\nGenBank Accession Number: BC041098\nGene Symbol: UGCGL1\nGene ID (NCBI): 56886\nRRID: AB_1288973\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYU2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961820841,"sku":"14170-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14170-1-ap","provider":"Iright","version":"1.0","type":"link"}