{"product_id":"proteintech-14196-1-ap","title":"Proteintech, 14196-1-AP, CREB5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CREB5 (14196-1-AP) by Proteintech is a Polyclonal antibody targeting CREB5 in WB, ELISA applications with reactivity to human samples\n14196-1-AP targets CREB5 in WB, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  HeLa cells,  human brain tissue,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3200\n\u003cb\u003eBackground Information\u003c\/b\u003e\ncyclic AMP responsive element binding protein 5 (CREB5), also known as CRE-BPA, \na member of the cAMP response element binding protein family, is a transcription factor specifically expressed in superficial zone articular chondrocytes and is required for TGF-β and EGFR signaling. Knockdown of CREB5 decreased the c-jun and c-fos expression levels in HC-a cells (PMID: 38549717). Increased CREB5 expression is positively correlated with tumor cell invasion and a poor prognosis for cancer patients with epithelial ovarian cancer and hepatocellular carcinoma (PMID: 38418476).This protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified (PMID: 33712729).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5399 Product name: Recombinant human CREB5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-369 aa of BC059400 Sequence: MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTTHRTDLNPIL Predict reactive species\nFull Name: cAMP responsive element binding protein 5\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC059400\nGene Symbol: CREB5\nGene ID (NCBI): 9586\nRRID: AB_2083832\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02930\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964704425,"sku":"14196-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14196-1-ap","provider":"Iright","version":"1.0","type":"link"}