{"product_id":"proteintech-14213-1-ap","title":"Proteintech, 14213-1-AP, MRAS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MRAS (14213-1-AP) by Proteintech is a Polyclonal antibody targeting MRAS in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n14213-1-AP targets MRAS in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse lung tissue,  human brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5433 Product name: Recombinant human MRAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC047690 Sequence: MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG Predict reactive species\nFull Name: muscle RAS oncogene homolog\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC047690\nGene Symbol: MRAS\nGene ID (NCBI): 22808\nRRID: AB_10950895\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14807\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869561016489,"sku":"14213-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14213-1-ap","provider":"Iright","version":"1.0","type":"link"}