{"product_id":"proteintech-14236-1-ap","title":"Proteintech, 14236-1-AP, SLC39A6\/ZIP6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC39A6\/ZIP6 (14236-1-AP) by Proteintech is a Polyclonal antibody targeting SLC39A6\/ZIP6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14236-1-AP targets SLC39A6\/ZIP6 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  A549 cells,  4T1 cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe zinc transporter LIV-1 (also known as SLC39A6 or ZIP6) was originally identified as an estrogen-induced gene in breast cancer cells. Elevated LIV-1 expression is reportedly related to cancer progression in various types of cancer, including breast, prostate, pancreatic, cervical and liver cancers. While correlation of LIV-1 and prognosis may vary. LIV 1 has 3 isoforms with MW of 85-100 (glycosylation and phosphorylation), 48 and 32 kDa while migrates as different bands in different lysates in SDS-PAGE. Furthermore, it has been reported in the papers that full-length SLC39A6\/ZIP6, as the pro-protein, is predicted to be 85 kDa and produces a 103 kDa band, the N-terminal fragment after cleavage is 35 kDa, and the cleaved ZIP6 is 68 kDa (PMID: 23919497, PMID: 26444413).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5478 Product name: Recombinant human SLC39A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-283 aa of BC039498 Sequence: HLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTNEEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKCHSHFHDTLGQSDDLIHHH Predict reactive species\nFull Name: solute carrier family 39 (zinc transporter), member 6\nCalculated Molecular Weight: 85 kDa\nObserved Molecular Weight: 85-103 kDa, 48 and 32 kDa\nGenBank Accession Number: BC039498\nGene Symbol: SLC39A6\/ZIP6\nGene ID (NCBI): 25800\nRRID: AB_10596924\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13433\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868921188521,"sku":"14236-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14236-1-ap","provider":"Iright","version":"1.0","type":"link"}