{"product_id":"proteintech-14246-1-ap","title":"Proteintech, 14246-1-AP, NR2E3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NR2E3 (14246-1-AP) by Proteintech is a Polyclonal antibody targeting NR2E3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n14246-1-AP targets NR2E3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse retina tissue, Y79 cells,  HepG2 cells,  rat retina tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: photoreceptor progenitor cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNR2E3, also known as PNR, encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. NR2E3 influences the development of photoreceptors and their differentiation into rod and cone types, and acts as a ranscriptional factor that is an activator of rod development and repressor of cone development [PMID:20725840]. It binds the promoter region of a number of rod- and cone-specific genes, including rhodopsin, M- and S-opsin and rod-specific phosphodiesterase beta subunit. [PMID:15689355]\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5503 Product name: Recombinant human NR2E3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-322 aa of BC041421 Sequence: MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN Predict reactive species\nFull Name: nuclear receptor subfamily 2, group E, member 3\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 43-45 kDa\nGenBank Accession Number: BC041421\nGene Symbol: NR2E3\nGene ID (NCBI): 10002\nRRID: AB_2155476\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5X4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868935278761,"sku":"14246-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14246-1-ap","provider":"Iright","version":"1.0","type":"link"}