{"product_id":"proteintech-14249-1-ap","title":"Proteintech, 14249-1-AP, MYL5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYL5 (14249-1-AP) by Proteintech is a Polyclonal antibody targeting MYL5 in WB, IHC, ELISA applications with reactivity to human,   mouse, rat samples\n14249-1-AP targets MYL5 in WB, IF, IHC, ELISA applications and shows reactivity with human,   mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, human brain tissue,  rat skeletal muscle tissue\nPositive IHC detected in: human cervical cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5522 Product name: Recombinant human MYL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC040050 Sequence: MDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE Predict reactive species\nFull Name: myosin, light chain 5, regulatory\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC040050\nGene Symbol: MYL5\nGene ID (NCBI): 4636\nRRID: AB_2266762\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02045\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869713911977,"sku":"14249-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14249-1-ap","provider":"Iright","version":"1.0","type":"link"}