{"product_id":"proteintech-14253-1-ap","title":"Proteintech, 14253-1-AP, UBL4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBL4A (14253-1-AP) by Proteintech is a Polyclonal antibody targeting UBL4A in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14253-1-AP targets UBL4A in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HUVEC cells,  mouse testis tissue,  human brain tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5526 Product name: Recombinant human UBL4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC043346 Sequence: MQLTVKALQGRECSLQVPEDELVSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKGFSK Predict reactive species\nFull Name: ubiquitin-like 4A\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC043346\nGene Symbol: UBL4A\nGene ID (NCBI): 8266\nRRID: AB_2288205\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11441\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868909555881,"sku":"14253-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14253-1-ap","provider":"Iright","version":"1.0","type":"link"}