{"product_id":"proteintech-14257-1-ap","title":"Proteintech, 14257-1-AP, MTP18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTP18 (14257-1-AP) by Proteintech is a Polyclonal antibody targeting MTP18 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14257-1-AP targets MTP18 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue,  mouse heart tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5530 Product name: Recombinant human MTP18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC038831 Sequence: MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS Predict reactive species\nFull Name: mitochondrial protein 18 kDa\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 16-18 kDa\nGenBank Accession Number: BC038831\nGene Symbol: MTP18\nGene ID (NCBI): 51537\nRRID: AB_2148123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UDX5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868984725673,"sku":"14257-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14257-1-ap","provider":"Iright","version":"1.0","type":"link"}