{"product_id":"proteintech-14300-1-ap","title":"Proteintech, 14300-1-AP, SULT1C4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SULT1C4 (14300-1-AP) by Proteintech is a Polyclonal antibody targeting SULT1C4 in WB, ELISA applications with reactivity to human samples\n14300-1-AP targets SULT1C4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSULT1C4 (Sulfotransferase 1C4), a member of a gene subfamily that includes three human\nmembers, SULT1C2, 1C3, and 1C4, is a dimeric Phase II drug-metabolizing enzyme primarily expressed in the developing fetus. SULT1C4 transcript is expressed in human intestinal and hepatic cell lines as well as in human liver specimens from different developmental stages, while SULT1C4 protein is barely detectable (PMID: 28222028, 32303576).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5259 Product name: Recombinant human SULT1C4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC058861 Sequence: MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK Predict reactive species\nFull Name: sulfotransferase family, cytosolic, 1C, member 4\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC058861\nGene Symbol: SULT1C4\nGene ID (NCBI): 27233\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75897\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887819346089,"sku":"14300-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14300-1-ap","provider":"Iright","version":"1.0","type":"link"}