{"product_id":"proteintech-14304-1-ap","title":"Proteintech, 14304-1-AP, ACK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACK1 (14304-1-AP) by Proteintech is a Polyclonal antibody targeting ACK1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14304-1-AP targets ACK1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, HepG2 cells,  HT-1080 cells,  A431 cells,  mouse brain tissue,  HeLa cells,  A549 cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNK2, also named ACK1, belongs to the protein kinase superfamily and Tyr protein kinase family. It is a non-receptor tyrosine-protein and serine\/threonine-protein kinase that is implicated in cell spreading and migration, cell survival, and cell proliferation. TNK2 transduces extracellular signals to cytosolic and nuclear effectors. It is a downstream effector of CDC42 which mediates CDC42-dependent cell migration via phosphorylation of BCAR1. TNK2 confers metastatic properties on cancer cells by negatively regulating tumor suppressors such as WWOX and positively regulating pro-survival factors such as AKT1 and AR. The 60-70kd band is the isoform 2 of TNK2. Isoform 1 and 3 is about 120-125kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5419 Product name: Recombinant human ACK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-385 aa of BC028164 Sequence: MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFL Predict reactive species\nFull Name: tyrosine kinase, non-receptor, 2\nCalculated Molecular Weight: 115 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC028164\nGene Symbol: TNK2\nGene ID (NCBI): 10188\nRRID: AB_11041713\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q07912\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869442461865,"sku":"14304-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14304-1-ap","provider":"Iright","version":"1.0","type":"link"}