{"product_id":"proteintech-14311-1-ap","title":"Proteintech, 14311-1-AP, Caspase 10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Caspase 10 (14311-1-AP) by Proteintech is a Polyclonal antibody targeting Caspase 10 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n14311-1-AP targets Caspase 10 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Staurosporine treated Jurkat cells, Apoptosised HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCaspase 10 (CASP10) is also called MCH4, is a member of the peptidase C14A family, and containstwo deatheffector (DED) domains.What is the molecular weight of CASP10?The molecular weight of CASP10 observed on Western blots may vary depending on which of its isoform,truncation, or cleavage forms are present. Full-length CASP10 has a propeptide with 219 amino acid and6 isoforms produced by alternative splicing.What is the tissue specificity of CASP10?CASP10 is detectable in most tissues. However, there is lower expression observed in brain, kidney, colon,prostate,and testis tissue.What is the function of CASP10?CASP10 plays a role in the cascade of caspases responsible for executing apoptosis. It is recruited toboththeFas and TNFR-1 receptors in a FADD dependentmanner.CASP10 is responsible forthe cleavageandactivation ofcaspases 3, 4, 6, 7, 8, and 9.CASP10 can be cleavedby granzyme Band autocatalytic activity togeneratetwoactive subunits from its inactive proenzyme form.What is the role of CASP10 in disease?Defects in CASP10 lead to autoimmune lymphoproliferative syndrome type 2A (ALPS2A), which is characterizedby abnormal lymphocyte and dendritic cell homeostasis, as well as immune regulatory defects (PMID:16446975).Defects in CASP10 are also a cause of familial non-Hodgkin lymphoma (NHL) and often marked by enlarged lymphnodes, weightloss and fever (PMID:12010812), and gastric cancers (GASC) (PMID:11973654).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5511 Product name: Recombinant human Caspase 10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 193-522 aa of BC042844 Sequence: AIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSNGNRATNGAPSLVSRGMQGASANTLNSETSTKRAAVYRMNRNHRGLCVIVNNHSFTSLKDRQGTHKDAEILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSSDEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQDSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILTAVNDDVSRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALSL Predict reactive species\nFull Name: caspase 10, apoptosis-related cysteine peptidase\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 59 kDa, 47 kDa, 30-35 kDa\nGenBank Accession Number: BC042844\nGene Symbol: Caspase 10\nGene ID (NCBI): 843\nRRID: AB_2290777\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92851\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868977909929,"sku":"14311-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14311-1-ap","provider":"Iright","version":"1.0","type":"link"}