{"product_id":"proteintech-14318-1-ap","title":"Proteintech, 14318-1-AP, CD141\/Thrombomodulin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD141\/Thrombomodulin (14318-1-AP) by Proteintech is a Polyclonal antibody targeting CD141\/Thrombomodulin in WB, IHC, ELISA applications with reactivity to human samples\n14318-1-AP targets CD141\/Thrombomodulin in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, A431 cells,  human heart tissue,  THP-1 cells\nPositive IHC detected in: human heart tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThrombomodulin, also known as CD141, is an endothelial cell surface glycoprotein that forms a 1:1 complex with the coagulation factor thrombin and plays an important role as a natural anticoagulant. Thrombomodulin serves to convert thrombin from a procoagulant protein into the activator for protein C. Once converted to activated protein C (APC), this protein serves as a major anticoagulant in blood (PMID: 2827310). Thrombomodulin is also located in other cells (keratinocytes, osteoblasts, macrophages,...) where it might be involved in cell differentiation or in inflammation (PMID: 9814688). In humans, thrombomodulin is encoded by the THBD gene. Mutations in this gene are a cause of thromboembolic disease, also known as inherited thrombophilia. Thrombomodulin is glycosylated and has an apparent molecular weight of 75 to 110 kDa (PMID: 1650405; 2827310).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5558 Product name: Recombinant human THBD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-350 aa of BC035602 Sequence: PAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECH Predict reactive species\nFull Name: thrombomodulin\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 90-100 kDa\nGenBank Accession Number: BC035602\nGene Symbol: THBD\nGene ID (NCBI): 7056\nRRID: AB_2201814\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07204\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868932362409,"sku":"14318-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14318-1-ap","provider":"Iright","version":"1.0","type":"link"}