{"product_id":"proteintech-14335-1-ap","title":"Proteintech, 14335-1-AP, CADM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CADM1 (14335-1-AP) by Proteintech is a Polyclonal antibody targeting CADM1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14335-1-AP targets CADM1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  A549 cells,  human placenta tissue,  mouse lung tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCADM1 (cell adhesion molecule 1), also referred to as SgIGSF, Necl-2 or TSLC-1, is a cell adhesion molecule belonging to the immunoglobulin superfamily. It can mediate homophilic and heterophilic cell-cell adhesion. CADM1 is expressed by a variety of cells including neurons, mast cells, spermatogonia, pancreatic islet cells, epithelial cells such as lung alveolar cells and biliary epithelial cells. CADM1 is involved in carcinoma pathogenesis and the expression of CADM1 is frequently down-regulated in various tumors derived from epithelial cells. It acts as a tumor suppressor in non-small-cell lung cancer (NSCLC) cells. (PMID: 18332875; 17326163; 20340131)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5621 Product name: Recombinant human CADM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-334 aa of BC047021 Sequence: DGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSR Predict reactive species\nFull Name: cell adhesion molecule 1\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 49-60 kDa\nGenBank Accession Number: BC047021\nGene Symbol: CADM1\nGene ID (NCBI): 23705\nRRID: AB_2243801\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BY67\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868977713321,"sku":"14335-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14335-1-ap","provider":"Iright","version":"1.0","type":"link"}