{"product_id":"proteintech-14353-1-ap","title":"Proteintech, 14353-1-AP, MEF2D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MEF2D (14353-1-AP) by Proteintech is a Polyclonal antibody targeting MEF2D in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n14353-1-AP targets MEF2D in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cell, HeLa cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMEF2D, also named as Myocyte-specific enhancer factor 2D, is a 521 amino acid protein, which belongs to the MEF2 family. MEF2D is expressed in t in myotubes and also in undifferentiated myoblasts. MEF2D as a transcriptional activator which binds specifically to the MEF2 element,  found in numerous muscle-specific and stress-induced genes. MEF2D mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. The calculated molecular weight of MEF2D is 55 kDa, but Phosphorylated MEF2D is 60 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5700 Product name: Recombinant human MEF2D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-514 aa of BC040949 Sequence: SLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK Predict reactive species\nFull Name: myocyte enhancer factor 2D\nCalculated Molecular Weight: 56 kDa\nObserved Molecular Weight: 55-60 kDa\nGenBank Accession Number: BC040949\nGene Symbol: MEF2D\nGene ID (NCBI): 4209\nRRID: AB_2878046\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14814\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868907065513,"sku":"14353-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14353-1-ap","provider":"Iright","version":"1.0","type":"link"}