{"product_id":"proteintech-14360-1-ap","title":"Proteintech, 14360-1-AP, RBM6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBM6 (14360-1-AP) by Proteintech is a Polyclonal antibody targeting RBM6 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14360-1-AP targets RBM6 in WB, IHC, IF\/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse spleen tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBM6, also named as DEF3, is a 1123 amino acid protein, which may interact with FAM168B. RBM6 is expressed ubiquitously in adults tissues. RBM6 specifically binds poly(G) RNA homopolymers in vitro. RBM6 exists some isoforms with MV 129 kDa, 69 kDa, and 59 kDa. onversely, fetal thymus and adult kidney express very little RBM6. In the hemopoietic system of mice, the expression of RBM6 is downregulated upon differentiation of progenitor cells into granulocytes but persists during macrophage development.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5743 Product name: Recombinant human RBM6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 302-601 aa of BC046643 Sequence: LPEEEEIKEKKPTSQGKSSSKKEMSKRDGKEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIKHQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD Predict reactive species\nFull Name: RNA binding motif protein 6\nCalculated Molecular Weight: 129 kDa\nObserved Molecular Weight: 129 kDa\nGenBank Accession Number: BC046643\nGene Symbol: RBM6\nGene ID (NCBI): 10180\nRRID: AB_2301175\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P78332\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869493317801,"sku":"14360-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14360-1-ap","provider":"Iright","version":"1.0","type":"link"}