{"product_id":"proteintech-14363-1-ap","title":"Proteintech, 14363-1-AP, RBM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBM3 (14363-1-AP) by Proteintech is a Polyclonal antibody targeting RBM3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n14363-1-AP targets RBM3 in WB, IHC, IF\/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  A375 cells,  Raji cells,  HepG2 cells,  Jurkat cells,  NIH\/3T3 cells\nPositive IHC detected in: human testis tissue, human lung tissue,  human brain tissue,  human kidney tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBM3, also named as RNPL, is a cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. It reduces the relative abundance of microRNAs, when overexpressed. RBM3 enhances phosphoryaltion of translation initiation factors and active polysome formation. It is up-regulated in human tumors. RBM3 is a potential proto-oncogenic proteins upon overexpression. (PMID: 19900510 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, squirrel\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5934 Product name: Recombinant human RBM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC006825 Sequence: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN Predict reactive species\nFull Name: RNA binding motif (RNP1, RRM) protein 3\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17-20 kDa\nGenBank Accession Number: BC006825\nGene Symbol: RBM3\nGene ID (NCBI): 5935\nRRID: AB_2269266\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P98179\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868849328297,"sku":"14363-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14363-1-ap","provider":"Iright","version":"1.0","type":"link"}