{"product_id":"proteintech-14376-1-ap","title":"Proteintech, 14376-1-AP, BMPR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BMPR2 (14376-1-AP) by Proteintech is a Polyclonal antibody targeting BMPR2 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n14376-1-AP targets BMPR2 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBMPs (bone morphogenetic protein) are involved in endochondral bone formation and embryogenesis. BMPR2 encodes a member of the (BMP) receptor family of transmembrane serine\/threonine kinases. It is a widely expressed receptor, with high mRNA expression during development in many tissues. Dimer of BMPR2 receptors (70-80 kD) forms a complex with a dimer of type I BMPR1(50-55 kD) in signal transduction. This antibody recognizes endogenous levels of total BMPR2 protein, including 115 kD precursor, 75 kD mature form and 150 kD dimer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5752 Product name: Recombinant human BMPR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 172-504 aa of BC052985 Sequence: YRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAEL Predict reactive species\nFull Name: bone morphogenetic protein receptor, type II (serine\/threonine kinase)\nCalculated Molecular Weight: 115 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC052985\nGene Symbol: BMPR2\nGene ID (NCBI): 659\nRRID: AB_10639044\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13873\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868923187369,"sku":"14376-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14376-1-ap","provider":"Iright","version":"1.0","type":"link"}