{"product_id":"proteintech-14396-1-ap","title":"Proteintech, 14396-1-AP, PASK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PASK (14396-1-AP) by Proteintech is a Polyclonal antibody targeting PASK in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14396-1-AP targets PASK in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, K-562 cells,  Jurkat cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: mouse testis tissue, human prostate hyperplasia tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAS (Per-Arnt-Sim) domains regulate the function of many intracellular signaling pathways in response to both extrinsic and intrinsic stimuli. PAS domain-containing serine\/threonine-protein kinase (PASK, also termed PAS-kinase or PASKIN) is an evolutionarily conserved nutrient responsive protein kinase. PASK links energy flux and protein synthesis in yeast and regulates glycogen synthesis in mammals. It has also been implicated in glucose-stimulated INS production in pancreatic beta-cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5893 Product name: Recombinant human PASK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 999-1323 aa of BC063585 Sequence: YSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRLLTS Predict reactive species\nFull Name: PAS domain containing serine\/threonine kinase\nCalculated Molecular Weight: 143 kDa\nObserved Molecular Weight: 180 kDa\nGenBank Accession Number: BC063585\nGene Symbol: PASK\nGene ID (NCBI): 23178\nRRID: AB_2878053\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96RG2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887751221417,"sku":"14396-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14396-1-ap","provider":"Iright","version":"1.0","type":"link"}