{"product_id":"proteintech-14471-1-ap","title":"Proteintech, 14471-1-AP, SLC32A1\/VGAT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC32A1\/VGAT (14471-1-AP) by Proteintech is a Polyclonal antibody targeting SLC32A1\/VGAT in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples\n14471-1-AP targets SLC32A1\/VGAT in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue, mouse brain tissue\nPositive IF-Fro detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC32A1, also known as VGAT (vesicular GABA transporter), functions in the uptake of GABA and glycine into synaptic vesicles. GABA (gamma-aminobutyric acid), is the major inhibitory neurotransmitter in the CNS. VGAT transports GABA and glycine into acidic vesicles and localizes to the synaptic vesicle in glycinergic and GABAergic neurons. And VGAT antibodies are useful markers for presynaptic GABAergic and glycinergic neurons.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, caenorhabditis elegans\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5843 Product name: Recombinant human SLC32A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-124 aa of BC053582 Sequence: MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWEAGWN Predict reactive species\nFull Name: solute carrier family 32 (GABA vesicular transporter), member 1\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC053582\nGene Symbol: VGAT\nGene ID (NCBI): 140679\nRRID: AB_10644324\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H598\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868895105193,"sku":"14471-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14471-1-ap","provider":"Iright","version":"1.0","type":"link"}