{"product_id":"proteintech-14486-1-ap","title":"Proteintech, 14486-1-AP, CD34 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD34 (14486-1-AP) by Proteintech is a Polyclonal antibody targeting CD34 in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n14486-1-AP targets CD34 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, TF-1 cells\nPositive IHC detected in: human tonsillitis tissue, human gliomas tissue,  human hysteromyoma tissue,  human liver cancer tissue,  human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue, human liver cancer tissue,  human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD34 is a 105- to 120-kDa glycophosphoprotein expressed on the majority of hematopoietic stem\/progenitor cells, bone marrow stromal cells, capillary endothelial cells, embryonic fibroblasts, and some nerve tissue. CD34 is a commonly used marker for identifying human hematopoietic stem\/progenitor cells and mediates cell adhesion and lymphocyte homing by binding L-selectin and E-selectin ligands. CD34 is also one of the best negative selection markers for characterizing and\/or isolating human MSCs from bone marrow and other sources. Along with other positive selection markers (such as CD29, CD44, CD90, CD105 and CD166), negative selection markers (such as CD34 and CD45) are used for MSC identification. The calculated molecular mass of human CD34 is 41 kDa, various forms with different molecular weights may be produced due to different glycosylation patterns and alternative splicing (PMID: 24375067; 15750786).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig, rabbit, bovine, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5887 Product name: Recombinant human CD34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-287 aa of BC039146 Sequence: DNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYS Predict reactive species\nFull Name: CD34 molecule\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 100-120 kDa\nGenBank Accession Number: BC039146\nGene Symbol: CD34\nGene ID (NCBI): 947\nRRID: AB_2228975\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P28906\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868830257321,"sku":"14486-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14486-1-ap","provider":"Iright","version":"1.0","type":"link"}