{"product_id":"proteintech-14492-1-ap","title":"Proteintech, 14492-1-AP, HBXIP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HBXIP (14492-1-AP) by Proteintech is a Polyclonal antibody targeting HBXIP in WB, IHC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n14492-1-AP targets HBXIP in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, U2OS cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human hepatocellular cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHBXIP, also named as XIP, belongs to the HBXIP family. It is originally identified by its interaction with the C-terminus of hepatitis B virus (HBV) X protein (HBx). HBXIP is a regulator of centrosome dynamics and cytokinesis. HBXIP is able to up-regulate S100A4 though activating STAT4 and inducing DNA methylation of PTEN. HBXIP has multiple isoforms with molecular weights of 8-10 kd and 18 kd. This antibody mainly recognizes the 10 kd isoform.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5894 Product name: Recombinant human HBXIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-173 aa of BC062619 Sequence: MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS Predict reactive species\nFull Name: hepatitis B virus x interacting protein\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC062619\nGene Symbol: HBXIP\nGene ID (NCBI): 10542\nRRID: AB_2878062\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: A0A8Z5A536\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868918272169,"sku":"14492-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14492-1-ap","provider":"Iright","version":"1.0","type":"link"}