{"product_id":"proteintech-14503-1-ap","title":"Proteintech, 14503-1-AP, 14-3-3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe 14-3-3 (14503-1-AP) by Proteintech is a Polyclonal antibody targeting 14-3-3 in WB, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n14503-1-AP targets 14-3-3 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse liver tissue,  mouse brain tissue,  Jurkat cells,  rat liver tissue,  mouse heart tissue,  NIH\/3T3 cells,  C6 cells\nPositive IP detected in: mouse lung tissue\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\n14-3-3 proteins are the first phosphoserine\/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5959 Product name: Recombinant human 14-3-3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-245 aa of BC056867 Sequence: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN Predict reactive species\nFull Name: tyrosine 3-monooxygenase\/tryptophan 5-monooxygenase activation protein, theta polypeptide\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC056867\nGene Symbol: 14-3-3 theta\nGene ID (NCBI): 10971\nRRID: AB_2218096\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P27348\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868880818345,"sku":"14503-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14503-1-ap","provider":"Iright","version":"1.0","type":"link"}