{"product_id":"proteintech-14519-1-ap","title":"Proteintech, 14519-1-AP, TCF7L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TCF7L1 (14519-1-AP) by Proteintech is a Polyclonal antibody targeting TCF7L1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14519-1-AP targets TCF7L1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse brain tissue,  JAR cells,  mouse liver tissue,  rat liver tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTCF7L1 is one of TCF\/LEF transcription factors that are mediators of the Wnt signaling pathway and are antagonized by the TGF-beta signaling pathway. It binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. It's necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules and the development of the barrier function of the epidermis\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5983 Product name: Recombinant human TCF7L1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 238-587 aa of BC058894 Sequence: GAVGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSRQMGSQPPLLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH Predict reactive species\nFull Name: transcription factor 7-like 1 (T-cell specific, HMG-box)\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 63-70 kDa\nGenBank Accession Number: BC058894\nGene Symbol: TCF7L1\nGene ID (NCBI): 83439\nRRID: AB_2287033\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HCS4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868930658473,"sku":"14519-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14519-1-ap","provider":"Iright","version":"1.0","type":"link"}