{"product_id":"proteintech-14524-1-ap","title":"Proteintech, 14524-1-AP, MYBBP1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYBBP1A (14524-1-AP) by Proteintech is a Polyclonal antibody targeting MYBBP1A in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n14524-1-AP targets MYBBP1A in WB, IHC, IF\/ICC, IP, RIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe protooncogene MYB is predominantly expressed in immature hemopoietic cells where it has an essential role in hemopoietic cell proliferation and differentiation. Oncogenically activated forms of MYB is generally N- and\/or C-terminal truncations of the normal MYB protein. Removal of the C terminus of MYB disrupts or deletes a region termed the negative regulatory domain (NRD), resulting in an increase in DNA binding, transactivation, and transformation by MYB. One feature of the NRD is a leucine zipper-like motif [PMID: 8302594]. Murine Myb-binding protein-1a (MYBBP1A), originally called P160, was identified by its ability to interact specifically with Myb via this leucine zipper-like motif. MYBBP1A modulates MYB activity upon binding to the MYB NRD [PMID: 10644447, 9447996].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6008 Product name: Recombinant human MYBBP1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 979-1328 aa of BC050546 Sequence: STALSSFLTKRNSPLTVPMFLSLFSRHPVLCQSLLPILVQHITGPVRPRRQACLLLQKTLSMREVRSCFEDPEWKQLMGQVLAKVTENLRVLGEAQTKAQHQQALSSLELLNVLFRTCKHEKLTLDLTVLLGVLQGQQQSLQQGAHSTGSSRLHDLYWQAMKTLGVQRPKLEKKDAKEIPSATQSPISKKRKKKGFLPETKKRKKRKSEDGTPAEDGTPAATGGSQPPSMGRKKRNRTKAKVPAQANGTPTTKSPAPGAPTRSPSTPAKSPKLQKKNQKPSQVNGAPGSPTEPAGQKQHQKALPKKGVLGKSPLSALARKKARLSLVIRSPSLLQSGAKKKAQVRKAGKP Predict reactive species\nFull Name: MYB binding protein (P160) 1a\nCalculated Molecular Weight: 149 kDa\nObserved Molecular Weight: 150-160 kDa\nGenBank Accession Number: BC050546\nGene Symbol: MYBBP1A\nGene ID (NCBI): 10514\nRRID: AB_2148137\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BQG0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868958118057,"sku":"14524-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14524-1-ap","provider":"Iright","version":"1.0","type":"link"}