{"product_id":"proteintech-14530-1-ap","title":"Proteintech, 14530-1-AP, RGS4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RGS4 (14530-1-AP) by Proteintech is a Polyclonal antibody targeting RGS4 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14530-1-AP targets RGS4 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse cerebellum tissue, mouse brain tissue,  PC-12 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human lung tissue, human brain tissue,  mouse brain tissue,  mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRegulator of G protein signaling (RGS) proteins are a large family of highly diverse, multifunctional signaling proteins. RGS4 is one of seven members of a classic R4 RGS protein that accelerates the GTPase activity of the Gai\/o and Gaq\/11 family members. RGS4 is highly expressed in multiple brain regions including the cerebral cortex, amygdala, hippocampus, and striatum. Extensive studies have demonstrated that RGS4 plays an important role in regulating smooth muscle contraction, cardiomyocyte development, neural plasticity and psychiatric disorders.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6029 Product name: Recombinant human RGS4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC051869 Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA Predict reactive species\nFull Name: regulator of G-protein signaling 4\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC051869\nGene Symbol: RGS4\nGene ID (NCBI): 5999\nRRID: AB_2269443\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49798\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868973060265,"sku":"14530-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14530-1-ap","provider":"Iright","version":"1.0","type":"link"}