{"product_id":"proteintech-14535-1-ap","title":"Proteintech, 14535-1-AP, GSTK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GSTK1 (14535-1-AP) by Proteintech is a Polyclonal antibody targeting GSTK1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14535-1-AP targets GSTK1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HUVEC cells,  Raji cells,  L02 cells,  mouse testis tissue,  rat testis tissue\nPositive IP detected in: Raji cells\nPositive IHC detected in: human testis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGSTK1, glutathione S-transferase kappa 1, belongs to the superfamily of glutathione S-transferase (GST), which is related to oxidative stress (PMID:16081649). GSTK1 expression is negatively correlated with obesity in mice and human, hypertrophic cardiomyopathy (PMID:21428694, PMID:27378925). GSTK1 was expressed in the peroxisomal and mitochondrial fractions and localized to peroxisomes (PubMed:14742434).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6036 Product name: Recombinant human GSTK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC050715 Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL Predict reactive species\nFull Name: glutathione S-transferase kappa 1\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC050715\nGene Symbol: GSTK1\nGene ID (NCBI): 373156\nRRID: AB_2115910\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2Q3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868906180777,"sku":"14535-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14535-1-ap","provider":"Iright","version":"1.0","type":"link"}