{"product_id":"proteintech-14541-1-ap","title":"Proteintech, 14541-1-AP, RBP7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBP7 (14541-1-AP) by Proteintech is a Polyclonal antibody targeting RBP7 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n14541-1-AP targets RBP7 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse adipose tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human colon cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human kidney tissue, human colon cancer tissue\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6045 Product name: Recombinant human RBP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC063013 Sequence: MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA Predict reactive species\nFull Name: retinol binding protein 7, cellular\nCalculated Molecular Weight: 15.5 kDa\nObserved Molecular Weight: 15-18 kDa\nGenBank Accession Number: BC063013\nGene Symbol: RBP7\nGene ID (NCBI): 116362\nRRID: AB_2179293\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96R05\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869750841513,"sku":"14541-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14541-1-ap","provider":"Iright","version":"1.0","type":"link"}