{"product_id":"proteintech-14545-1-ap","title":"Proteintech, 14545-1-AP, CLIC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLIC1 (14545-1-AP) by Proteintech is a Polyclonal antibody targeting CLIC1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14545-1-AP targets CLIC1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse colon tissue, human colon tissue,  human pancreas tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChloride intracellular channel protein 1 (CLIC1) is a member of the chloride intracellular channel protein family. It plays a crucial role in various cellular processes, including the regulation of chloride ion transport, cell viability, and mitochondrial function. CLIC1 is involved in the formation of membrane-inserted channels that facilitate chloride ion movement, which is essential for maintaining cellular homeostasis and function (PMID: 32116799). Additionally, CLIC1 has been implicated in cancer progression, where it influences cell proliferation, migration, and invasion (PMID: 38027011).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6049 Product name: Recombinant human CLIC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-241 aa of BC064527 Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK Predict reactive species\nFull Name: chloride intracellular channel 1\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27-32 kDa\nGenBank Accession Number: BC064527\nGene Symbol: CLIC1\nGene ID (NCBI): 1192\nRRID: AB_2081809\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00299\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868923678889,"sku":"14545-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14545-1-ap","provider":"Iright","version":"1.0","type":"link"}