{"product_id":"proteintech-14546-1-ap","title":"Proteintech, 14546-1-AP, LDHC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LDHC (14546-1-AP) by Proteintech is a Polyclonal antibody targeting LDHC in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14546-1-AP targets LDHC in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MDA-MB-231 cells,  PC-3 cells,  mouse testis tissue,  rat testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLDHC, also named as CT32 and LDH-X, belongs to the LDH\/MDH superfamily and LDH family. LDHC is a possible role in sperm motility. LDHC catalyzes the reaction: (S)-lactate + NAD+ = pyruvate + NADH. LDHC is a testis-specific isoform. Abnormal LDHC expression is associated with several forms of cancer. The antibody has no cross reaction with LDHA and LDHB.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6050 Product name: Recombinant human LDHC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-332 aa of BC064388 Sequence: MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF Predict reactive species\nFull Name: lactate dehydrogenase C\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 31-35 kDa\nGenBank Accession Number: BC064388\nGene Symbol: LDHC\nGene ID (NCBI): 3948\nRRID: AB_3085437\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P07864\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887702495401,"sku":"14546-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14546-1-ap","provider":"Iright","version":"1.0","type":"link"}