{"product_id":"proteintech-14547-1-ap","title":"Proteintech, 14547-1-AP, MSRA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MSRA (14547-1-AP) by Proteintech is a Polyclonal antibody targeting MSRA in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14547-1-AP targets MSRA in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, human kidney tissue,  mouse kidney tissue,  rat kidney tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMethionine sulfoxide reductase A(MSRA), is a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine.MSRA has some isoforms with MW of 19~26 kDa. MSRA functions in the repair of oxidatively damaged proteins to restore biological activity. Transfection of MSRA reduced colony formation and the invasiveness of HCC cell lines.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6053 Product name: Recombinant human MSRA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of BC054033 Sequence: MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK Predict reactive species\nFull Name: methionine sulfoxide reductase A\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 24-26 kDa\nGenBank Accession Number: BC054033\nGene Symbol: MSRA\nGene ID (NCBI): 4482\nRRID: AB_2148366\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UJ68\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868894187689,"sku":"14547-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14547-1-ap","provider":"Iright","version":"1.0","type":"link"}