{"product_id":"proteintech-14575-1-ap","title":"Proteintech, 14575-1-AP, SDHC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SDHC (14575-1-AP) by Proteintech is a Polyclonal antibody targeting SDHC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14575-1-AP targets SDHC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse brain tissue,  mouse liver tissue,  rat liver tissue,  mouse heart tissue,  mouse kidney tissue,  mouse lung tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSDHC(Succinate dehydrogenase cytochrome b560 subunit, mitochondrial) is also named as CYB560, SDH3 and belongs to the cytochrome b560 family. It is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Defects in SDHC are the cause of paragangliomas type 3 (PGL3) and paraganglioma and gastric stromal sarcoma (PGGSS). It has a transit peptide of 29 amino acid and has 5 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag5775 Product name: Recombinant human SDHC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-169 aa of BC033626 Sequence: MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM Predict reactive species\nFull Name: succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC033626\nGene Symbol: SDHC\nGene ID (NCBI): 6391\nRRID: AB_2183291\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99643\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868936687785,"sku":"14575-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14575-1-ap","provider":"Iright","version":"1.0","type":"link"}