{"product_id":"proteintech-14590-1-ap","title":"Proteintech, 14590-1-AP, FBXO2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO2 (14590-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14590-1-AP targets FBXO2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, Caco-2 cells,  HCT 116 cells,  LoVo cells\nPositive IHC detected in: mouse brain tissue, rat brain tissue,  rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nF-box only protein 2 (FBXO2), also known as FBG1 or Fbs1, is a cytoplasmic protein and ubiquitin ligase with high-mannose glycoprotein specificity. FBXO2 plays a significant role in regulating normal and abnormal neuron functions as a ubiquitin-mediated degrader of several neuron glycoproteins. In addition, it has been reported that FBXO2 targets insulin receptors for degradation by ubiquitin, thereby modulating insulin signaling. Recently, emerging evidence demonstrated that FBXO2 was also strongly associated with the occurrence and development of malignant tumors, including gastric cancer and colorectal cancer. The overexpression of FBXO2 significantly promotes PTC cell proliferation (PMID: 39343799). Lactic acid mediates the selective loading of FBXO2 into SEVs through SORBS3\/FLOT1, thereby inducing hepatocyte apoptosis, which is an important mechanism of liver fibrosis caused by myogenic SEVs (PMID: 39879982).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6122 Product name: Recombinant human FBXO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-296 aa of BC025233 Sequence: MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLAALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQVIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP Predict reactive species\nFull Name: F-box protein 2\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33-40 kDa\nGenBank Accession Number: BC025233\nGene Symbol: FBXO2\nGene ID (NCBI): 26232\nRRID: AB_2104394\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UK22\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868917420201,"sku":"14590-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14590-1-ap","provider":"Iright","version":"1.0","type":"link"}