{"product_id":"proteintech-14608-1-ap","title":"Proteintech, 14608-1-AP, PKN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PKN2 (14608-1-AP) by Proteintech is a Polyclonal antibody targeting PKN2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n14608-1-AP targets PKN2 in WB, IHC, IF\/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, K-562 cells,  HeLa cells,  HEK-293 cells,  COLO 320 cells,  SKOV-3 cells,  HEK-293T cells\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human colon cancer tissue, human lung cancer tissue,  human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6164 Product name: Recombinant human PKN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC062620 Sequence: MDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPPREPRILSEEEQEMFRDFDYIADWC Predict reactive species\nFull Name: protein kinase N2\nCalculated Molecular Weight: 112 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC062620\nGene Symbol: PKN2\nGene ID (NCBI): 5586\nRRID: AB_10638487\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16513\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869486502057,"sku":"14608-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14608-1-ap","provider":"Iright","version":"1.0","type":"link"}