{"product_id":"proteintech-14625-1-ap","title":"Proteintech, 14625-1-AP, RABEP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RABEP2 (14625-1-AP) by Proteintech is a Polyclonal antibody targeting RABEP2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14625-1-AP targets RABEP2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  HeLa cells,  mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human cervical cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRABEP2, also named as RABPT5B, plays a role in membrane trafficking and in homotypic early endosome fusion. It has two isoforms with MW 59-63 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6197 Product name: Recombinant human RABEP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-299 aa of BC058900 Sequence: MAAAAPVAADDDERRRRPGAALEDSRSQEGANGEAESGELSRLRAELAGALAEMETMKAVAEVSESTKAEAVAAVQRQCQEEVASLQAILKDSISSYEAQITALKQERQQQQQDCEEKERELGRLKQLLSRAYPLDSLEKQMEKAHEDSEKLREIVLPMEKEIEELKAKLLRAEELIQEIQRRPRHAPSLHGSTELLPLSRDPSPPLEPLEELSGDGGPAAEAFAHNCDDSASISSFSLGGGVGSSSSLPQSRQGLSPEQEETASLVSTGTLVPEGIYLPPPGYQLVPDTQWEQLQTEM Predict reactive species\nFull Name: rabaptin, RAB GTPase binding effector protein 2\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 59-62 kDa\nGenBank Accession Number: BC058900\nGene Symbol: RABEP2\nGene ID (NCBI): 79874\nRRID: AB_2175655\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H5N1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868972503209,"sku":"14625-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14625-1-ap","provider":"Iright","version":"1.0","type":"link"}