{"product_id":"proteintech-14630-1-ap","title":"Proteintech, 14630-1-AP, RMI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RMI1 (14630-1-AP) by Proteintech is a Polyclonal antibody targeting RMI1 in WB, IP, IHC, ELISA applications with reactivity to human samples\n14630-1-AP targets RMI1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRMI1 is an essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. RMI1 promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. RMI1 is required for BLM phosphorylation during mitosis. Within the BLM complex, RMI1 is required for BLM and TOP3A stability. (PMID: 16537486, PMID: 16595695, PMID: 15775963)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6208 Product name: Recombinant human RMI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC064937 Sequence: MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAHSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIER Predict reactive species\nFull Name: RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae)\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC064937\nGene Symbol: RMI1\nGene ID (NCBI): 80010\nRRID: AB_2301203\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H9A7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920664233,"sku":"14630-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14630-1-ap","provider":"Iright","version":"1.0","type":"link"}