{"product_id":"proteintech-14639-1-ap","title":"Proteintech, 14639-1-AP, CHMP1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHMP1B (14639-1-AP) by Proteintech is a Polyclonal antibody targeting CHMP1B in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14639-1-AP targets CHMP1B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, human heart tissue,  mouse heart tissue,  rat heart tissue,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6222 Product name: Recombinant human CHMP1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC065933 Sequence: MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV Predict reactive species\nFull Name: chromatin modifying protein 1B\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC065933\nGene Symbol: CHMP1B\nGene ID (NCBI): 57132\nRRID: AB_2079353\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7LBR1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868916469929,"sku":"14639-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14639-1-ap","provider":"Iright","version":"1.0","type":"link"}