{"product_id":"proteintech-14652-1-ap","title":"Proteintech, 14652-1-AP, ARPC3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARPC3 (14652-1-AP) by Proteintech is a Polyclonal antibody targeting ARPC3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14652-1-AP targets ARPC3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  K-562 cells,  NIH\/3T3 cells,  mouse brain,  rat brain\nPositive IHC detected in: human colon cancer tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, bovine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6249 Product name: Recombinant human ARPC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC067747 Sequence: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ Predict reactive species\nFull Name: actin related protein 2\/3 complex, subunit 3, 21kDa\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC067747\nGene Symbol: ARPC3\nGene ID (NCBI): 10094\nRRID: AB_2059933\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15145\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868947239081,"sku":"14652-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14652-1-ap","provider":"Iright","version":"1.0","type":"link"}