{"product_id":"proteintech-14672-1-ap","title":"Proteintech, 14672-1-AP, Septin 11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Septin 11 (14672-1-AP) by Proteintech is a Polyclonal antibody targeting Septin 11 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n14672-1-AP targets Septin 11 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  HeLa cells,  HT-1080 cells,  mouse brain tissue,  mouse colon tissue,  mouse small intestine tissue,  SH-SY5Y cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human ovary tissue,  human kidney tissue,  human lung tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells,  HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6342 Product name: Recombinant human SEPT11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC063615 Sequence: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHAC Predict reactive species\nFull Name: septin 11\nCalculated Molecular Weight: 49 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC063615\nGene Symbol: Septin 11\nGene ID (NCBI): 55752\nRRID: AB_2301682\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NVA2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988657833,"sku":"14672-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14672-1-ap","provider":"Iright","version":"1.0","type":"link"}