{"product_id":"proteintech-14674-1-ap","title":"Proteintech, 14674-1-AP, ADHFE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADHFE1 (14674-1-AP) by Proteintech is a Polyclonal antibody targeting ADHFE1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14674-1-AP targets ADHFE1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, mouse kidney tissue,  mouse liver tissue,  rat kidney tissue\nPositive IHC detected in: human colon tissue, human colon cancer tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ADHFE1 gene encodes hydroxyacid-oxoacid transhydrogenase which is responsible for the oxidation of 4-hydroxybutyrate in mammalian tissues. It belongs to the iron-containing alcohol dehydrogenase family. ADHFE1 has 4 isoforms produced by alternative splicing with the MW of 50, 45, 32, 27 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6382 Product name: Recombinant human ADHFE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-255 aa of BC064634 Sequence: MAVSNIRYGAAVTKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFMEAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKPLIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSGFDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVNSTDK Predict reactive species\nFull Name: alcohol dehydrogenase, iron containing, 1\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 50 kDa, 40-45 kDa\nGenBank Accession Number: BC064634\nGene Symbol: ADHFE1\nGene ID (NCBI): 137872\nRRID: AB_2221451\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8IWW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869631893673,"sku":"14674-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14674-1-ap","provider":"Iright","version":"1.0","type":"link"}