{"product_id":"proteintech-14681-1-ap","title":"Proteintech, 14681-1-AP, ASNS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASNS (14681-1-AP) by Proteintech is a Polyclonal antibody targeting ASNS in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n14681-1-AP targets ASNS in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, ARPE-19 cells,  Jurkat cells,  K-562 cell\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human retinoblastoma tissue, human gliomas tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAsparagine synthetase [glutamine-hydrolyzing](ASNS) is also named as TS11. The asparagine synthetase gene, encoding the enzyme that catalyzes the synthesis of asparagine and glutamate using glutamine and aspartate, is a gene for which transcription is highly regulated by the nutritional status of the cell(PMID:15385533). ASNS has some isoforms with the MW of 55-64 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6393 Product name: Recombinant human ASNS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 247-561 aa of BC014621 Sequence: LMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVKA Predict reactive species\nFull Name: asparagine synthetase\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 55-64 kDa\nGenBank Accession Number: BC014621\nGene Symbol: ASNS\nGene ID (NCBI): 440\nRRID: AB_2060119\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08243\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868836024489,"sku":"14681-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14681-1-ap","provider":"Iright","version":"1.0","type":"link"}