{"product_id":"proteintech-14695-1-ap","title":"Proteintech, 14695-1-AP, Collagen Type I Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Collagen Type I (14695-1-AP) by Proteintech is a Polyclonal antibody targeting Collagen Type I in WB, IHC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, pig samples\n14695-1-AP targets Collagen Type I in WB, IHC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-87 MG cells, human placenta tissue,  MG-63 cells,  pig skin tissue,  Saos-2 cells\nPositive IP detected in: U-87 MG cells\nPositive IHC detected in: human colon tissue, human breast cancer tissue,  human oesophagus cancer tissue,  human placenta tissue,  human skin cancer tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse skin tissue\nPositive FC (Intra) detected in: SW480 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nType I collagen, the major structural component of connective tissues such as skin, tendon and bone, is the most abundant and widely expressed collagen in humans (PMID: 7620364; 8645190; 9016532). Type I collagen is a heterotrimer comprising one alpha 2(I) and two alpha 1(I) chains which are encoded by the unlinked loci COL1A2 and COL1A1 respectively.  Mutations in COL1A2 gene are associated with osteogenesis imperfecta, Ehlers-Danlos syndrome, idiopathic osteoporosis, and atypical Marfan syndrome. This antibody raised against 1017-1366 aa of human pro-alpha 2 chain of type l collagen can recognize collagen alpha 2(1) chain and C-terminal propeptide of pro-alpha 2(1) chain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human, mouse, rat, pig, rabbit, canine, chicken, bovine, toad, duck\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6281 Product name: Recombinant human COL1A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1017-1366 aa of BC054498 Sequence: RGLPGLKGHNGLQGLPGIAGHHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGHPGTVGPAGIRGPQGHQGPAGPPGPPGPPGPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTGETCIRAQPENIPAKNWYRSSKDKKHVWLGETINAGSQFEYNVEGVTSKEMATQLAFMRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK Predict reactive species\nFull Name: collagen, type I, alpha 2\nCalculated Molecular Weight: 1366 aa, 130 kDa\nObserved Molecular Weight: 130-160 kDa，210-250kDa\nGenBank Accession Number: BC054498\nGene Symbol: COL1A2\nGene ID (NCBI): 1278\nRRID: AB_2082037\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08123\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887965753513,"sku":"14695-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14695-1-ap","provider":"Iright","version":"1.0","type":"link"}