{"product_id":"proteintech-14705-1-ap","title":"Proteintech, 14705-1-AP, PCP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PCP4 (14705-1-AP) by Proteintech is a Polyclonal antibody targeting PCP4 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples\n14705-1-AP targets PCP4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human cerebellum tissue, mouse brain tissue,  mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse cerebellum tissue, mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPCP4, also named as PEP19, belongs to a family of proteins involved in calcium transduction signals and binds calmodulin via an IQ motif, in a calcium independent manner. It is mainly expressed in ectoderm and neuroectoderm comprising neural crest derived cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6388 Product name: Recombinant human PCP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC013791 Sequence: MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS Predict reactive species\nFull Name: Purkinje cell protein 4\nCalculated Molecular Weight: 7 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC013791\nGene Symbol: PCP4\nGene ID (NCBI): 5121\nRRID: AB_2878075\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P48539\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868920205481,"sku":"14705-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14705-1-ap","provider":"Iright","version":"1.0","type":"link"}