{"product_id":"proteintech-14718-1-ap","title":"Proteintech, 14718-1-AP, PGD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PGD (14718-1-AP) by Proteintech is a Polyclonal antibody targeting PGD in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14718-1-AP targets PGD in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Jurkat cells,  mouse liver tissue,  rat liver tissue\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human liver cancer tissue,  human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPGD, also named as PGDH, belongs to the 6-phosphogluconate dehydrogenase family. PGD catalyses the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate in the context of the oxidative part of the pentose phosphate pathway. PGD is important for the production of NADPH, which is necessary for reductive biosynthesis, such as the formation of lipids and nucleotides, and the activity of enzymes involved in maintaining cell integrity, in combatting oxidative stress and in the first line of immunological defence. (PMID: 35234135)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6444 Product name: Recombinant human PGD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 137-483 aa of BC000368 Sequence: YGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA Predict reactive species\nFull Name: phosphogluconate dehydrogenase\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 53 kDa, 45 kDa\nGenBank Accession Number: BC000368\nGene Symbol: PGD\nGene ID (NCBI): 5226\nRRID: AB_2236801\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52209\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868861976745,"sku":"14718-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14718-1-ap","provider":"Iright","version":"1.0","type":"link"}