{"product_id":"proteintech-14719-1-ap","title":"Proteintech, 14719-1-AP, PHGDH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PHGDH (14719-1-AP) by Proteintech is a Polyclonal antibody targeting PHGDH in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14719-1-AP targets PHGDH in WB, IHC, IF\/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HEK-293 cells,  mouse brain tissue,  HeLa cells,  HepG2 cells,  MCF-7 cells,  MDA-MB-453s cells,  rat brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human lymphoma tissue, human breast hyperplasia tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPHGDH(D-3-phosphoglycerate dehydrogenase) is also named as 3-PGDH, PGDH3 and belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. It catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+\/NADH as a cofactor. 3-PGDH deficiency is a rare recessive inborn error in the biosynthesis of the amino acid L-serine characterized clinically by congenital microcephaly, psychomotor retardation, and intractable seizures(PMID:19235232 ).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6445 Product name: Recombinant human PHGDH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 186-533 aa of BC000303 Sequence: FGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF Predict reactive species\nFull Name: phosphoglycerate dehydrogenase\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC000303\nGene Symbol: PHGDH\nGene ID (NCBI): 26227\nRRID: AB_2283938\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43175\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868834975913,"sku":"14719-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14719-1-ap","provider":"Iright","version":"1.0","type":"link"}