{"product_id":"proteintech-14749-1-ap","title":"Proteintech, 14749-1-AP, CORO1C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CORO1C (14749-1-AP) by Proteintech is a Polyclonal antibody targeting CORO1C in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14749-1-AP targets CORO1C in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, human heart tissue,  SGC-7901 cells,  HeLa cells,  mouse skeletal muscle tissue\nPositive IP detected in: mouse heart tissue, mouse skeletal muscle tissue\nPositive IHC detected in: human cervical cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCORO1C also known as HCRNN4, belongs to the WD repeat coronin family. CORO1C contains 5 N-terminal trp-asp (WD) repeats and a C-terminal coiled-coil motif. It was reported to regulate actin‐dependent processes by assembling F-actin. CORO1C promoted the invasion of breast cancer and glioma cells by specifically promoting the formation of invadopodia(PMID: 30974047).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6488 Product name: Recombinant human CORO1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-306 aa of BC002342 Sequence: MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLN Predict reactive species\nFull Name: coronin, actin binding protein, 1C\nCalculated Molecular Weight: 53 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC002342\nGene Symbol: CORO1C\nGene ID (NCBI): 23603\nRRID: AB_2230110\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9ULV4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868905525417,"sku":"14749-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14749-1-ap","provider":"Iright","version":"1.0","type":"link"}