{"product_id":"proteintech-14776-1-ap","title":"Proteintech, 14776-1-AP, SEC22B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC22B (14776-1-AP) by Proteintech is a Polyclonal antibody targeting SEC22B in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n14776-1-AP targets SEC22B in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  rat liver tissue,  mouse brain tissue,  rat brain tissue,  MDA-MB-231 cells\nPositive IHC detected in: human breast cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSoluble N-ethylmaleimide-sensitive factor (NSF) attachment protein receptor (SNARE) proteins are critical components of the membrane fusion machinery (PMID: 20163564). SEC22B is a SNARE involved in endoplasmic reticulum (ER)\/Golgi membrane trafficking. SEC22B localizes to the ER-Golgi intermediate compartment (ERGIC) and has been identified as a regulator of antigen crosspresentation (PMID: 22153078).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6077 Product name: Recombinant human SEC22B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-215 aa of BC001364 Sequence: VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL Predict reactive species\nFull Name: SEC22 vesicle trafficking protein homolog B (S. cerevisiae)\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC001364\nGene Symbol: SEC22B\nGene ID (NCBI): 9554\nRRID: AB_2186083\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75396\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988559529,"sku":"14776-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14776-1-ap","provider":"Iright","version":"1.0","type":"link"}