{"product_id":"proteintech-14778-1-ap","title":"Proteintech, 14778-1-AP, AIFM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AIFM3 (14778-1-AP) by Proteintech is a Polyclonal antibody targeting AIFM3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n14778-1-AP targets AIFM3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, U-87 MG cells\nPositive IHC detected in: human ovary tumor tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nApoptosis-inducing factor, mitochondrion-associated 3 (AIFM3) is a mitochondrial protein\/flavoenzyme and its gene is located on chromosome 22q11.21. Mature human AIFM3 protein consists of 598 amino acids with a molecular weight of 66 kDa and is predominantly localized in the mitochondria. AIFM3 is widely expressed in many tissues, and breast cancer tissues and cholangiocarcinoma tissue (PMID: 32664187).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6278 Product name: Recombinant human AIFM3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 355-598 aa of BC032485 Sequence: AHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS Predict reactive species\nFull Name: apoptosis-inducing factor, mitochondrion-associated, 3\nCalculated Molecular Weight: 67 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC032485\nGene Symbol: AIFM3\nGene ID (NCBI): 150209\nRRID: AB_2258090\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96NN9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869805924521,"sku":"14778-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14778-1-ap","provider":"Iright","version":"1.0","type":"link"}