{"product_id":"proteintech-14787-1-ap","title":"Proteintech, 14787-1-AP, CBS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CBS (14787-1-AP) by Proteintech is a Polyclonal antibody targeting CBS in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n14787-1-AP targets CBS in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  mouse colon tissue,  NCI-H1299 cells,  rat kidney tissue,  HepG2 cells,  LNCaP cells,  MCF-7 cells,  SKOV-3 cells,  THP-1 cells,  mouse kidney tissue\nPositive IP detected in: mouse kidney tissue\nPositive IHC detected in: human pancreas cancer tissue, human colon tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe CBS gene encodes cystathionine beta-synthase, which catalyzes the first irreversible step of transsulfuration. The CBS enzyme is a homotetramer of 63-kD subunits and requires pyridoxal phosphate and heme for activity(PMID:11230183). CBS protein is localized in most areas of the brain, but predominantly in the cell bodies and neuronal processes of Purkinje cells and Ammon's horn neurons(PMID:12588964).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, rabbit, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6437 Product name: Recombinant human CBS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 206-551 aa of BC000440 Sequence: VAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK Predict reactive species\nFull Name: cystathionine-beta-synthase\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 61-63 kDa\nGenBank Accession Number: BC000440\nGene Symbol: CBS\nGene ID (NCBI): 875\nRRID: AB_2070970\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35520\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868826521769,"sku":"14787-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14787-1-ap","provider":"Iright","version":"1.0","type":"link"}