{"product_id":"proteintech-14820-1-ap","title":"Proteintech, 14820-1-AP, GPR37\/Pael-R Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR37\/Pael-R (14820-1-AP) by Proteintech is a Polyclonal antibody targeting GPR37\/Pael-R in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n14820-1-AP targets GPR37\/Pael-R in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3200\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe orphan G protein-coupled receptor GPR37, also known as PAELR (parkin-associated endothelin receptor-like receptor) or ETBR-LP-1 (endothelin B receptor-like protein 1), is a 613 aa, multi-pass membrane protein predominantly expressed in the brain. It is a substrate of parkin (PARK2). When overexpressed in cells, GPR37 tends to become insoluble, unfolded, and ubiquitinated in vivo. Accumulation of the unfolded protein may lead to dopaminergic neuronal death in juvenile Parkinson disease (JPD). This antibody recognizes endogenous GPR37, which migrates as an approximately 50-55 kDa band in SDS-PAGE (PMID:17519329).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag6591 Product name: Recombinant human GPR37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-264 aa of BC040007 Sequence: SRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAV Predict reactive species\nFull Name: G protein-coupled receptor 37 (endothelin receptor type B-like)\nCalculated Molecular Weight: 67 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC040007\nGene Symbol: GPR37\nGene ID (NCBI): 2861\nRRID: AB_2232549\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15354\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868941471913,"sku":"14820-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-14820-1-ap","provider":"Iright","version":"1.0","type":"link"}